PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G01340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 359aa    MW: 39600.4 Da    PI: 7.6503
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G01340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.12.4e-51191581128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtd e++  yL +k  + +++    i evd++k+ePwdLp+k+k +ekewyfFs++d ky+tg r+nratk+gyWkatgkd+e+++
  OGLUM11G01340.1  19 LPPGFRFHPTDAEVILSYLLQKFLNPSFTS-LPIGEVDLNKCEPWDLPSKAKMGEKEWYFFSHKDMKYPTGMRTNRATKEGYWKATGKDREIFN 111
                      79*************************888.56***************99999****************************************9 PP

              NAM  95 k.............kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                    +++lvg+kktLvfy grapkg+kt+Wvmhe+rl
  OGLUM11G01340.1 112 LqptsyggssnnknNKQLVGMKKTLVFYMGRAPKGTKTNWVMHEFRL 158
                      888999888887766677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-5916185IPR003441NAC domain
PROSITE profilePS5100554.11119185IPR003441NAC domain
PfamPF023651.9E-2520158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MVETSTSLVK LEQDGSLFLP PGFRFHPTDA EVILSYLLQK FLNPSFTSLP IGEVDLNKCE  60
PWDLPSKAKM GEKEWYFFSH KDMKYPTGMR TNRATKEGYW KATGKDREIF NLQPTSYGGS  120
SNNKNNKQLV GMKKTLVFYM GRAPKGTKTN WVMHEFRLHA NLHNDNPNLR LNPKDEWVVC  180
KVFHKKGDDR EAINKQQAQA AAVDQYSAGT PNNGSSVEAG DDDDDLFQLD SIIDPSIYFS  240
NSSAANILSA PPNMSNSVVA ANYGASTTTT GTASAGSFQQ QPNYCSLINK SISSSNVSSW  300
NNMPPPPPVA GGGVHGIGSS YSLQHQAAMV KALRDVIRLP NPLGMPQYKL DDAYLWDSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-501718615166NAC domain-containing protein 19
4dul_A3e-501718615166NAC domain-containing protein 19
1ut7_B3e-501718615166NO APICAL MERISTEM PROTEIN
1ut7_A3e-501718615166NO APICAL MERISTEM PROTEIN
1ut4_B3e-501718615166NO APICAL MERISTEM PROTEIN
1ut4_A3e-501718615166NO APICAL MERISTEM PROTEIN
3swp_D3e-501718618169NAC domain-containing protein 19
3swp_C3e-501718618169NAC domain-containing protein 19
3swp_B3e-501718618169NAC domain-containing protein 19
3swp_A3e-501718618169NAC domain-containing protein 19
3swm_D3e-501718618169NAC domain-containing protein 19
3swm_C3e-501718618169NAC domain-containing protein 19
3swm_B3e-501718618169NAC domain-containing protein 19
3swm_A3e-501718618169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679220.0AK067922.1 Oryza sativa Japonica Group cDNA clone:J013121J10, full insert sequence.
GenBankCT8295090.0CT829509.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA103O19, full insert sequence.
GenBankKP0331910.0KP033191.1 Oryza sativa cultivar Dong Jin NAC-related protein 45 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615868.10.0PREDICTED: NAC domain-containing protein 77-like
SwissprotQ5CD171e-176NAC77_ORYSJ; NAC domain-containing protein 77
TrEMBLA0A0E0BES80.0A0A0E0BES8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA034716-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51203063
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.22e-73Arabidopsis NAC domain containing protein 87